PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010418-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 88aa    MW: 10790.4 Da    PI: 9.8179
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010418-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.19.4e-092968445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+++  k+ G + W++Ia +++ gR ++++  +w 
    NNU_010418-RA 29 MTEQEEDLIYRMYKLVGDR-WNLIAGRIP-GRKPEEIERFWI 68
                     7****************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.9E-62573IPR001005SANT/Myb domain
CDDcd001671.32E-52867No hitNo description
Gene3DG3DSA:1.10.10.602.1E-102968IPR009057Homeodomain-like
PfamPF002496.0E-82968IPR001005SANT/Myb domain
PROSITE profilePS500906.1563067IPR017877Myb-like domain
SuperFamilySSF466899.36E-83068IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MDKRRRKQAK IIHYDSEEVS SIEWEFINMT EQEEDLIYRM YKLVGDRWNL IAGRIPGRKP  60
EEIERFWIMR HGEGFAGRRK VREIKYSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
117DKRRRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261513.12e-58PREDICTED: transcription factor TRY-like
SwissprotQ8GV052e-42TRY_ARATH; Transcription factor TRY
TrEMBLA0A087GAN56e-42A0A087GAN5_ARAAL; Uncharacterized protein
STRINGPOPTR_0002s17030.12e-41(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.11e-43MYB_related family protein